Skip to main content

Table 3 Peptide sequences identified from rat plasma

From: Peptidomic profiles of post myocardial infarction rats affinity depleted plasma using matrix-assisted laser desorption/ionization time of flight (MALDI-ToF) mass spectrometry

MALDI M/Z Peptide Sequence Mass (Calc) Δ MALDI MZ - Monoisotopic Mass (Calc)
1955.00 QVNASSSSNSLAEPQAPQAA 1955.9184 −0.92
2041.00 IVSSLHQAAAAAACLSRQASS 2041.0374 −0.04
2041.00 ALSGLAAGASSVAGAAGAPGGGGFAP 2041.023 −0.02
2799.00 M[1]HITGPEDGDPVRPGVAM[1]TDLATGLFA 2799.3203 −0.32
3488.00 PFHEVYCASKFALEGLCESLAILLPLFGVHVS 3488.7876 −0.79
3504.00 LSQPEDQAEINTGSALFIDKEQPILSEFQEK 3503.7307 0.27
3504.00 PTGDGQPSLEPPMAAAFGAPGIMSSPYAGAAGFAPAI 3503.6377 0.36
3661.00 LHRAETMTASELLGIPPGVKEKLHLLYQKSKSA 3661.0025 0.00